PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC018151.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GATA
Protein Properties Length: 254aa    MW: 27800.5 Da    PI: 9.0459
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC018151.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.76.8e-18166199134
          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                   C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  EcC018151.10 166 CMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 199
                   99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.1E-16160210IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.503160196IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.37E-15164223No hitNo description
Gene3DG3DSA:3.30.50.106.4E-15164197IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.58E-14165214No hitNo description
PfamPF003201.5E-15166199IPR000679Zinc finger, GATA-type
PROSITE patternPS003440166191IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
YEDIVQMEWL SNLMDDSFSS DPLTINDQDP SKAQPVSHAQ FQTSSPISVL DSSSSCTDEK  60
AAPRSPEAIN LARCGRARSK RPRPATFNPR PPVQLISPTS SVGENPQPVD SESHVESRPV  120
IKIPRQVNPE QKKKKKIKFT MSTAAAAAAS ADASQSSATA QAVRKCMHCE ITKTPQWRAG  180
PMGPKTLCNA CGVRYKSGRL FPEYRPAASP TFIPSLHSNS HKKVLEMRSN VGDPEAMANP  240
PELIPNRAVE MEYM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17983KRPRP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010067308.10.0PREDICTED: GATA transcription factor 8-like
TrEMBLA0A059BGU30.0A0A059BGU3_EUCGR; Uncharacterized protein
STRINGPOPTR_0010s23010.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49752751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.26e-41GATA family protein